Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Metarhizium robertsii Signal peptidase complex catalytic subunit SEC11 (SEC11)

This Recombinant Metarhizium robertsii Signal peptidase complex catalytic subunit SEC11 (SEC11) spans the amino acid sequence from region 1-172.

Product Specifications

Product Name Alternative

Signal peptidase complex catalytic subunit SEC11, EC= 3.4.21.89, Signal peptidase I

UniProt

E9F8V9

Expression Region

1-172

Origin

Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) (Metarhizium anisopliae)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSSLQNPRQAAAQLMNFAMILSTAFMMWKGLSVATDSPSPIVVVLSGSMEPAFQRGDLL LLWNRNVWQETAVGEVVVYNVKGKDIPIVHRVVRKFGTGDKAKLLTKGDNNNADDTDLYA RGQDYLEREDIIGSVIGYFPFVGYVTILLSEHPWLKTVMLGIMGLLVVIQRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL
BNC040437-500 1x 500 µL

CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF594 conjugate, 0.1mg/mL
BNC940160-100 1x 100 µL

CD20 (B9E9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL
BNC402853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL
BNC680633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Milk Fat Globulin (MFG-06), CF488A conjugate, 0.1mg/mL
BNC880227-100 1x 100 µL

Milk Fat Globulin (MFG-06), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF647 conjugate, 0.1mg/mL
BNC470276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details