Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0803 (MJ0803)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0803 (MJ0803) spans the amino acid sequence from region 1-172.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0803

UniProt

Q58213

Expression Region

1-172

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSYGVILISYVGLIKLALAGILCYGIYLAIKSEKNLIKDALFVYKDNNFNVFGKKYALM IFLAFGFPIFFIGSFLYLFWEKLPEGFRFSLTFAITFFVLFIFGLLFVKYKIRVCKNGIY VGFRFITWKGFEGYKIENNKIILIGKKGVTYPVHLKYSKELEDIIKNYLKKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfyve19 ORF Vector (Mouse) (pORF)
ORF062671 1.0 µg DNA

Zfyve19 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
SH2D1B Antibody, Biotin conjugated
MBS7049111-01 0.05 mg

SH2D1B Antibody, Biotin conjugated

Sign In for Pricing
View Details
SH2D1B Antibody, Biotin conjugated
MBS7049111-02 0.1 mg

SH2D1B Antibody, Biotin conjugated

Sign In for Pricing
View Details
SH2D1B Antibody, Biotin conjugated
MBS7049111-03 5x 0.1 mg

SH2D1B Antibody, Biotin conjugated

Sign In for Pricing
View Details
TRIM72 Mouse Monoclonal Antibody
AMM83351-01 1 Each

TRIM72 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
TRIM72 Mouse Monoclonal Antibody
AMM83351-02 50 µL

TRIM72 Mouse Monoclonal Antibody

Sign In for Pricing
View Details