Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0803 (MJ0803)
This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0803 (MJ0803) spans the amino acid sequence from region 1-172.
Product Specifications
Product Name Alternative
Uncharacterized protein MJ0803
UniProt
Q58213
Expression Region
1-172
Origin
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNSYGVILISYVGLIKLALAGILCYGIYLAIKSEKNLIKDALFVYKDNNFNVFGKKYALM IFLAFGFPIFFIGSFLYLFWEKLPEGFRFSLTFAITFFVLFIFGLLFVKYKIRVCKNGIY VGFRFITWKGFEGYKIENNKIILIGKKGVTYPVHLKYSKELEDIIKNYLKKI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV782650 1.0 µg DNA
RPS8P1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
Sign In for Pricing
View Details 
ARP41656_P050-HRP 100 µL
ALAD Antibody - N-terminal region : HRP (ARP41656_P050-HRP)
Sign In for Pricing
View Details 
MBS1206929-01 0.02 mg (E-Coli)
Recombinant Haemophilus parasuis serovar 5 Trigger factor (tig)
Sign In for Pricing
View Details