Recombinant Neurospora crassa Signal peptidase complex catalytic subunit sec11 (sec11)
This Recombinant Neurospora crassa Signal peptidase complex catalytic subunit sec11 (sec11) spans the amino acid sequence from region 1-172.
Product Specifications
Product Name Alternative
Signal peptidase complex catalytic subunit sec11, EC= 3.4.21.89, Signal peptidase I
UniProt
Q7RY44
Expression Region
1-172
Origin
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MLSGLANPRQAAVQLMNFGLILSTAFMMWKGISVITDSPSPIVVVLSGSMEPAFQRGDLL FLWNRNVLAETSVGEIVVYNVKGKDIPIVHRIVRKFGKGPEAKLLTKGDNNVSDDTELYA SGQDYLVRNDIIGSVFAYIPFVGYVTILLSEHPWLKTVMLGLMGLVVVLQRE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC700391-500 1x 500 µL
CD81 / TAPA-1 (1.3.3.22), CF770 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040257-500 1x 500 µL
Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042078-500 1x 500 µL
TCL1 (T-Cell Marker) (TCL1/2078), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details