Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit b (atpF)

This Recombinant Prochlorococcus marinus ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-172.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q7V5S5

Expression Region

1-172

Origin

Prochlorococcus marinus (strain MIT 9313)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISPLFFASEGGFGLNLDLFDANIVNLAIVIFGLYKFLPPFIGGILERRRVAIMADLQDS EDRLLKATEALAAAKKDLAAAHQKAEQIREDCKLRAEAIRLDSEKRTVEEMARVKQGATA DLNAEASRASAQLRREAARMAIENALSALPGKLNTEAQSKLVSQSIKNLGEA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HO-1 Antibody
E18-5393-1 50 µg - 50 µL

HO-1 Antibody

Sign In for Pricing
View Details
Recombinant Human SUCLA2 Protein
E30P5966 20 µg

Recombinant Human SUCLA2 Protein

Sign In for Pricing
View Details
Malonganenone A
MBS5774181 Inquire

Malonganenone A

Sign In for Pricing
View Details
CD8a Recombinant Protein (Mouse)
RP122735 100 µg

CD8a Recombinant Protein (Mouse)

Sign In for Pricing
View Details
GNG7 Antibody; Biotin conjugated
MBS7004190-01 0.05 mg

GNG7 Antibody; Biotin conjugated

Sign In for Pricing
View Details
GNG7 Antibody; Biotin conjugated
MBS7004190-02 0.1 mg

GNG7 Antibody; Biotin conjugated

Sign In for Pricing
View Details