Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit b (atpF)

This Recombinant Prochlorococcus marinus ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-172.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q7V5S5

Expression Region

1-172

Origin

Prochlorococcus marinus (strain MIT 9313)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISPLFFASEGGFGLNLDLFDANIVNLAIVIFGLYKFLPPFIGGILERRRVAIMADLQDS EDRLLKATEALAAAKKDLAAAHQKAEQIREDCKLRAEAIRLDSEKRTVEEMARVKQGATA DLNAEASRASAQLRREAARMAIENALSALPGKLNTEAQSKLVSQSIKNLGEA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human AGER Protein, Fc Tag
KMPH3297 50 µg

Human AGER Protein, Fc Tag

Sign In for Pricing
View Details
MAN1B1 Rabbit pAb
orb2718551-01 50 µL

MAN1B1 Rabbit pAb

Sign In for Pricing
View Details
MAN1B1 Rabbit pAb
orb2718551-02 100 µL

MAN1B1 Rabbit pAb

Sign In for Pricing
View Details
PPPDE1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
37505124 3x 1.0µg DNA

PPPDE1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Nipbl (NM_027707) Mouse Tagged ORF Clone
MG215782 10 µg

Nipbl (NM_027707) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
rno-miR-3075 miRNA Antagomir
MBS8321132-01 10 nmol

rno-miR-3075 miRNA Antagomir

Sign In for Pricing
View Details