Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit b (atpF)

This Recombinant Prochlorococcus marinus ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-172.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A2C6X3

Expression Region

1-172

Origin

Prochlorococcus marinus (strain MIT 9303)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISPLFFASEGGFGLNLDLFDANIVNLAIVIFGLYKFLPPFVGGILERRRVAILADLKDA EERLLKATEALAHAKKDLAAAHQKAEQIREDCKLRAEAIRLDSEKRTVEEMARVKQGATA DLNAEASRASAQLRREAARMAIENALSALPGKLNADAQAQLVSQSIKNLGEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PSMC3 qPCR Primer Pair
QH05141S 200 Tests

Human PSMC3 qPCR Primer Pair

Sign In for Pricing
View Details
Recombinant Campylobacter hominis tRNA modification GTPase MnmE (mnmE)
MBS1057579-01 0.02 mg (E-Coli)

Recombinant Campylobacter hominis tRNA modification GTPase MnmE (mnmE)

Sign In for Pricing
View Details
Recombinant Campylobacter hominis tRNA modification GTPase MnmE (mnmE)
MBS1057579-02 0.02 mg (Yeast)

Recombinant Campylobacter hominis tRNA modification GTPase MnmE (mnmE)

Sign In for Pricing
View Details
Recombinant Campylobacter hominis tRNA modification GTPase MnmE (mnmE)
MBS1057579-03 0.1 mg (E-Coli)

Recombinant Campylobacter hominis tRNA modification GTPase MnmE (mnmE)

Sign In for Pricing
View Details
Recombinant Campylobacter hominis tRNA modification GTPase MnmE (mnmE)
MBS1057579-04 0.1 mg (Yeast)

Recombinant Campylobacter hominis tRNA modification GTPase MnmE (mnmE)

Sign In for Pricing
View Details
Recombinant Campylobacter hominis tRNA modification GTPase MnmE (mnmE)
MBS1057579-05 0.02 mg (Baculovirus)

Recombinant Campylobacter hominis tRNA modification GTPase MnmE (mnmE)

Sign In for Pricing
View Details