Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0210.1 (MJ0210.1)
This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0210.1 (MJ0210.1) spans the amino acid sequence from region 1-172.
Product Specifications
Product Name Alternative
Uncharacterized protein MJ0210.1
UniProt
P81232
Expression Region
1-172
Origin
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MFNKVAFMNIPMMDLIMIVIAIIITIGSFLFIAYLIFKYSKIKKQVKIIREVKINLPKML KSNMIKNSFLIISLLCFYFGMLYIAGELVISHILFIAICWIVVFLYIIIKGETRGYICEE GLLVSGVLYSWKEFKDVKIEDNYIILTTPIHKIVIKKEKGVENILKNYLKRN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040040-500 1x 500 µL
CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC051037-100 1x 100 µL
CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940026-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
