Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 2 Envelope protein UL45 (UL45)

This Recombinant Human herpesvirus 2 Envelope protein UL45 (UL45) spans the amino acid sequence from region 1-172.

Product Specifications

Product Name Alternative

Envelope protein UL45, 18 kDa protein

UniProt

P89465

Expression Region

1-172

Origin

Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFRASGPAYQPLAPAASPARARVPAVAWIGVGAIVGAFALVAALVLVPPRSSWGLSPCD SGWQEFNAGCVAWDPTPVEHEQAVGGCSAPATLIPRAAAKHLAALTRVQAERSSGYWWVN GDGIRTCLRLVDSVSGIDEFFEELAIRICYYPRSPGGFVRFVTSIRNALGLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Amino-4- (4-bromophenyl) pyrimidine-5-carbonitrile
OR14363 1 g

2-Amino-4- (4-bromophenyl) pyrimidine-5-carbonitrile

Sign In for Pricing
View Details
FUNDC1 Antibody
E38PA3610 100 µL

FUNDC1 Antibody

Sign In for Pricing
View Details
SingleFlowEx CD3 PE-Cy™7
ED7477 1 mL

SingleFlowEx CD3 PE-Cy™7

Sign In for Pricing
View Details
Caspase 6 Blocking Peptide
MBS8232158-01 1 mg

Caspase 6 Blocking Peptide

Sign In for Pricing
View Details
Caspase 6 Blocking Peptide
MBS8232158-02 5 mg

Caspase 6 Blocking Peptide

Sign In for Pricing
View Details
Caspase 6 Blocking Peptide
MBS8232158-03 5x 5 mg

Caspase 6 Blocking Peptide

Sign In for Pricing
View Details