Recombinant Human herpesvirus 2 Envelope protein UL45 (UL45)
This Recombinant Human herpesvirus 2 Envelope protein UL45 (UL45) spans the amino acid sequence from region 1-172.
Product Specifications
Product Name Alternative
Envelope protein UL45, 18 kDa protein
UniProt
P89465
Expression Region
1-172
Origin
Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAFRASGPAYQPLAPAASPARARVPAVAWIGVGAIVGAFALVAALVLVPPRSSWGLSPCD SGWQEFNAGCVAWDPTPVEHEQAVGGCSAPATLIPRAAAKHLAALTRVQAERSSGYWWVN GDGIRTCLRLVDSVSGIDEFFEELAIRICYYPRSPGGFVRFVTSIRNALGLP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15357840 1 Vial
Lentiviral human ENPP7 sgRNA gene knockout kit - Lentiviral human ENPP7 sgRNA gene knockout kit (25)
Sign In for Pricing
View Details 
K0994805 3x 1.0 µg
HSDL2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details