Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marchantia polymorpha Putative ATP synthase protein YMF19 (YMF19)

This Recombinant Marchantia polymorpha Putative ATP synthase protein YMF19 (YMF19) spans the amino acid sequence from region 1-172.

Product Specifications

Product Name Alternative

Putative ATP synthase protein YMF19, EC= 3.6.3.14, Mitochondrial protein YMF19

UniProt

P38462

Expression Region

1-172

Origin

Marchantia polymorpha (Liverwort) (Marchantia aquatica)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPQLDQFTYLTQFVWLCVFYMTFYVLLYNDGLPKISRIIKLRKRLVSQEKVGAEQSNDRV EQDVVFKECFQASANYLYSSVSGASKWCKGMVQLANAHKLQRMNKDYVCSLGEISVSQVI KKNALSTLSPSTYQTTSLASRQTTALNKIYVLRGQKRTLAKIKNGPRKKKIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trioctyl Trimellitate
TRC-T804400-1G 1 g

Trioctyl Trimellitate

Sign In for Pricing
View Details
cis/trans-Nepetalactol
TRC-N390065-50MG 50 mg

cis/trans-Nepetalactol

Sign In for Pricing
View Details
Diglycolic anhydride
TRC-D446338-500MG 500 mg

Diglycolic anhydride

Sign In for Pricing
View Details
CD20 / MS4A1 (B-Cell Marker), CF594 conjugate, 0.1mg/mL
BNC941498-100 1x 100 µL

CD20 / MS4A1 (B-Cell Marker), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Water Chiller BCHI-304
BCHI-304 Each

Water Chiller BCHI-304

Sign In for Pricing
View Details
PPIG Rabbit Polyclonal Antibody
TA380213 100 µL

PPIG Rabbit Polyclonal Antibody

Sign In for Pricing
View Details