Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 1 Envelope protein UL45 (UL45)

This Recombinant Human herpesvirus 1 Envelope protein UL45 (UL45) spans the amino acid sequence from region 1-172.

Product Specifications

Product Name Alternative

Envelope protein UL45, 18 kDa protein

UniProt

P28987

Expression Region

1-172

Origin

Human herpesvirus 1 (strain KOS) (HHV-1) (Human herpes simplex virus 1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPLRASEHAYRPLGPGTPPMRARLPAAAWVGVGTIIGGVVIIAALVLVPSRASWALSPCD SGWHEFNLGCISWDPTPMEHEQAVGGCSAPATLIPRAAAKQLAAVARVQSARSSGYWWVS GDGIRARLRLVDGVGGIDQFCEEPALRICYYPRSPGGFVQFVTSTRNALGLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

O-Phospho-L-tyrosine
TRC-P365000-250MG 250 mg

O-Phospho-L-tyrosine

Sign In for Pricing
View Details
SIGLEC1 / CD169 / Sialoadhesin (HSn 7D2), CF647 conjugate, 0.1mg/mL
BNC472843-500 1x 500 µL

SIGLEC1 / CD169 / Sialoadhesin (HSn 7D2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (rNGFR/1965), CF405S conjugate, 0.1mg/mL
BNC042551-500 1x 500 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (rNGFR/1965), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Crisp1 activation kit by CRISPRa
GA200113 1 Kit

Mouse Crisp1 activation kit by CRISPRa

Sign In for Pricing
View Details
PTP4A3 Rabbit Polyclonal Antibody
AP09464PU-S 50 µL

PTP4A3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VTA1 (NM_016485) Human Recombinant Protein
TP305442L 1 mg

VTA1 (NM_016485) Human Recombinant Protein

Sign In for Pricing
View Details