Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 1 Envelope protein UL45 (UL45)

This Recombinant Human herpesvirus 1 Envelope protein UL45 (UL45) spans the amino acid sequence from region 1-172.

Product Specifications

Product Name Alternative

Envelope protein UL45, 18 kDa protein

UniProt

P28987

Expression Region

1-172

Origin

Human herpesvirus 1 (strain KOS) (HHV-1) (Human herpes simplex virus 1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPLRASEHAYRPLGPGTPPMRARLPAAAWVGVGTIIGGVVIIAALVLVPSRASWALSPCD SGWHEFNLGCISWDPTPMEHEQAVGGCSAPATLIPRAAAKQLAAVARVQSARSSGYWWVS GDGIRARLRLVDGVGGIDQFCEEPALRICYYPRSPGGFVQFVTSTRNALGLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFR (GFR1195 + 31G7), 0.2mg/mL
BNUB1200-100 1x 100 µL

EGFR (GFR1195 + 31G7), 0.2mg/mL

Sign In for Pricing
View Details
P2X2 (P2RX2) (NM_170682) Human Recombinant Protein
TP316207L 1 mg

P2X2 (P2RX2) (NM_170682) Human Recombinant Protein

Sign In for Pricing
View Details
NFE4 (NM_001085386) Human Over-expression Lysate
LY421283 100 µg

NFE4 (NM_001085386) Human Over-expression Lysate

Sign In for Pricing
View Details
FANCI (NM_001113378) Human Over-expression Lysate
LC426403 20 µg

FANCI (NM_001113378) Human Over-expression Lysate

Sign In for Pricing
View Details
POLR2K Rabbit Polyclonal Antibody
TA369504 100 µL

POLR2K Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ccr10 Mouse Gene Knockout Kit (CRISPR)
KN502833 1 Kit

Ccr10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details