Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 1 Envelope protein UL45 (UL45)

This Recombinant Human herpesvirus 1 Envelope protein UL45 (UL45) spans the amino acid sequence from region 1-172.

Product Specifications

Product Name Alternative

Envelope protein UL45, 18 kDa protein

UniProt

P28987

Expression Region

1-172

Origin

Human herpesvirus 1 (strain KOS) (HHV-1) (Human herpes simplex virus 1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPLRASEHAYRPLGPGTPPMRARLPAAAWVGVGTIIGGVVIIAALVLVPSRASWALSPCD SGWHEFNLGCISWDPTPMEHEQAVGGCSAPATLIPRAAAKQLAAVARVQSARSSGYWWVS GDGIRARLRLVDGVGGIDQFCEEPALRICYYPRSPGGFVQFVTSTRNALGLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Granulocyte-Colony Stimulating Factor (G-CSF) (CSF3) (CSF3/900), 0.2mg/mL
BNUB0900-100 1x 100 µL

Granulocyte-Colony Stimulating Factor (G-CSF) (CSF3) (CSF3/900), 0.2mg/mL

Sign In for Pricing
View Details
WDR26 Antibody
KC-41682-01 50 μL

WDR26 Antibody

Sign In for Pricing
View Details
WDR26 Antibody
KC-41682-02 100 µL

WDR26 Antibody

Sign In for Pricing
View Details
WDR26 Antibody
KC-41682-03 1 mL

WDR26 Antibody

Sign In for Pricing
View Details
Card19 Mouse Gene Knockout Kit (CRISPR)
KN500016 1 Kit

Card19 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Heparan Sulphate Proteoglycan (A7L6), CF647 conjugate, 0.1mg/mL
BNC470315-100 1x 100 µL

Heparan Sulphate Proteoglycan (A7L6), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details