Recombinant Pyrenophora teres f. teres Signal peptidase complex catalytic subunit sec11 (sec11)
This Recombinant Pyrenophora teres f. teres Signal peptidase complex catalytic subunit sec11 (sec11) spans the amino acid sequence from region 1-173.
Product Specifications
Product Name Alternative
Signal peptidase complex catalytic subunit sec11, EC= 3.4.21.89, Signal peptidase I
UniProt
E3RR70
Expression Region
1-173
Origin
Pyrenophora teres f. teres (strain 0-1) (Barley net blotch fungus) (Drechslera teres f. teres)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MLGIADMQPRQLAAQVLNFALVLSTAFMMWKGLSAASDSPSPIVVVLSGSMEPAFQRGDL LFLWNRGADTQVGEIVVYNVKGKDIPIVHRVVRRYGGGKTPLRLLTKGDNNLADDTELYA AGQSFLNRQEDVIGSVVGFIPFVGYVTILLSEHPWLKQVMLGMMGVMVVLQRE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400030-500 1x 500 µL
Insulin (2D11-H5), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940158-500 1x 500 µL
Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882216-500 1x 500 µL
CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 