Recombinant Lysinibacillus sphaericus UPF0316 protein Bsph_0745 (Bsph_0745)
This Recombinant Lysinibacillus sphaericus UPF0316 protein Bsph_0745 (Bsph_0745) spans the amino acid sequence from region 1-173.
Product Specifications
Product Name Alternative
UPF0316 protein Bsph_0745
UniProt
B1HYA2
Expression Region
1-173
Origin
Lysinibacillus sphaericus (strain C3-41)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MQSIVLILILQLVYVPFLTLRTIFLVKNITFLAAIFGMLEMLVYVFGLSLVFSGKQSMLA MVVYAVGFGLGIFLGAKIERKLAIGYVYTTINTQNKNEELVRFLRNEGFAVTIYVGEGRD SNRYKYEILTKRNRETELFQIVEQFEPNAFIISYEPKSFKGGFLLARMKAKQK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680026-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882332-500 1x 500 µL
Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742289-100 1x 100 µL
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2289R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740204-100 1x 100 µL
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details