Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Apolipoprotein O (APOO)

This Recombinant Bovine Apolipoprotein O (APOO) spans the amino acid sequence from region 26-198.

Product Specifications

Product Name Alternative

Apolipoprotein O, Protein FAM121B

UniProt

Q148H0

Expression Region

26-198

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KKDSPHKDTVKVNELSLYSVPEHQSKYVEEPRTQLEESISHLRHYCEPYTSWCQEKYSQN KPKIQSLVQWGLDSYEYLQNAPPGFFPRLGVIGFAGVVGLVLARGSKIKKLVYPPGFMGF AASLYYPQQAIVFVQVSGEKLYDWGLRGYIVVEDLWKENFQKSGNVKNSPGNK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bis-PEG17-PFP ester
sc-496490 100 mg

Bis-PEG17-PFP ester

Sign In for Pricing
View Details
10- (triisopropylsilyl) -10H-phenothiazine
OR27695 1 Each

10- (triisopropylsilyl) -10H-phenothiazine

Sign In for Pricing
View Details
Monkey Actin, gamma enteric smooth muscle (ACTG2) ELISA kit
GTR10453962 96 Well

Monkey Actin, gamma enteric smooth muscle (ACTG2) ELISA kit

Sign In for Pricing
View Details
EGLN1 Polyclonal Antibody
A-2702-100 100 µL

EGLN1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal CD45RA Antibody (T200/8144R) [Alexa Fluor 594]
NBP3-20794AF594 0.1 mL

Rabbit Monoclonal CD45RA Antibody (T200/8144R) [Alexa Fluor 594]

Sign In for Pricing
View Details
PAX3 (Paired Box 3, CDHS, HUP2, MGC120381, MGC120382, MGC120383, MGC120384, MGC134778, WS1) (Biotin)
249755-Biotin 100 µL

PAX3 (Paired Box 3, CDHS, HUP2, MGC120381, MGC120382, MGC120383, MGC120384, MGC134778, WS1) (Biotin)

Sign In for Pricing
View Details