Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Apolipoprotein O (APOO)

This Recombinant Bovine Apolipoprotein O (APOO) spans the amino acid sequence from region 26-198.

Product Specifications

Product Name Alternative

Apolipoprotein O, Protein FAM121B

UniProt

Q148H0

Expression Region

26-198

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KKDSPHKDTVKVNELSLYSVPEHQSKYVEEPRTQLEESISHLRHYCEPYTSWCQEKYSQN KPKIQSLVQWGLDSYEYLQNAPPGFFPRLGVIGFAGVVGLVLARGSKIKKLVYPPGFMGF AASLYYPQQAIVFVQVSGEKLYDWGLRGYIVVEDLWKENFQKSGNVKNSPGNK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBP17 (FNBP1) Human Gene Knockout Kit (CRISPR)
KN411011 1 Kit

FBP17 (FNBP1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Monoclonal Lipocalin-2/NGAL Antibody (28) [DyLight 680]
NBP1-30006FR 0.1 mL

Mouse Monoclonal Lipocalin-2/NGAL Antibody (28) [DyLight 680]

Sign In for Pricing
View Details
FAM3B (NM_206964) Human Over-expression Lysate
LC403719 20 µg

FAM3B (NM_206964) Human Over-expression Lysate

Sign In for Pricing
View Details
SREB/GPR85 Antibody
orb1533957 50 µg

SREB/GPR85 Antibody

Sign In for Pricing
View Details
ETS2 Antibody
orb1334424 100 µg

ETS2 Antibody

Sign In for Pricing
View Details
Human RAP1GAP2 knockdown cell line
ABC-KD12658 1 Vial

Human RAP1GAP2 knockdown cell line

Sign In for Pricing
View Details