Recombinant Syntrophomonas wolfei subsp. wolfei ATP synthase subunit b (atpF)
This Recombinant Syntrophomonas wolfei subsp. wolfei ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-173.
Product Specifications
Product Name Alternative
ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b
UniProt
Q0AUC9
Expression Region
1-173
Origin
Syntrophomonas wolfei subsp. wolfei (strain Goettingen)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MPVPQPDGKTPAFGNLYAIGWSAVNFLVLLALMYKFAYGPINNMLEQRTNAIEGSLKHAE EVKLEVEQMRKETASNLAESRKEAQEIVARATKAAEESKNEIIAKAKEESTLIKNKAAAE IQAATEQAKLELKDSAVSLAILAAEKVLSRAINDDDHKNLVKQFVNEAGDLLC
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
B-M5-75LD-B3-R 20 Mounts/Base Assemblies
MicroLoop LD Assembly; box of 20 assemblies
Sign In for Pricing
View Details 