Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit b (atpF)

This Recombinant Staphylococcus aureus ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-173.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q2YUJ7

Expression Region

1-173

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTETANLFVLGAAGGVEWGTVIVQVLTFIVLLALLKKFAWGPLKDVMDKRERDINRDIDD AEQAKLNAQKLEEENKQKLKETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQ SEINSQKERAIADINNQVSELSVLIASKVLRKEISEQDQKALVDKYLKEAGDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horse Protein quaking (QKI) ELISA Kit
orb1655627-01 48 Tests

Horse Protein quaking (QKI) ELISA Kit

Sign In for Pricing
View Details
Horse Protein quaking (QKI) ELISA Kit
orb1655627-02 96 Tests

Horse Protein quaking (QKI) ELISA Kit

Sign In for Pricing
View Details
P53 Rabbit mAb
E60M1196 100 µL

P53 Rabbit mAb

Sign In for Pricing
View Details
Glutathione S-Transferase (GST) discontinued
G8135-01A 2 mL

Glutathione S-Transferase (GST) discontinued

Sign In for Pricing
View Details
F11R
AAP61362-100UG 100 µg

F11R

Sign In for Pricing
View Details
Bottle Top Dispenser, 5.0mL to 50.0mL
GBTD-50 1 Each

Bottle Top Dispenser, 5.0mL to 50.0mL

Sign In for Pricing
View Details