Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit b (atpF)

This Recombinant Staphylococcus aureus ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-173.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q7A4E7

Expression Region

1-173

Origin

Staphylococcus aureus (strain N315)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTETANLFVLGAAGGVEWGTVIVQVLTFIVLLALLKKFAWGPLKDVMDKRERDINRDIDD AEQAKLNAQKLEEENKQKLKETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQ SEINSQKERAIADINNQVSELSVLIASKVLRKEISEQDQKALVDKYLKEAGDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPARC Antibody
orb192255-01 50 μL

SPARC Antibody

Sign In for Pricing
View Details
SPARC Antibody
orb192255-02 100 µL

SPARC Antibody

Sign In for Pricing
View Details
Venetoclax Impurity 25
RM-V051425-01 10 mg

Venetoclax Impurity 25

Sign In for Pricing
View Details
Venetoclax Impurity 25
RM-V051425-02 25 mg

Venetoclax Impurity 25

Sign In for Pricing
View Details
Venetoclax Impurity 25
RM-V051425-03 50 mg

Venetoclax Impurity 25

Sign In for Pricing
View Details
Venetoclax Impurity 25
RM-V051425-04 100 mg

Venetoclax Impurity 25

Sign In for Pricing
View Details