Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit b (atpF)

This Recombinant Staphylococcus aureus ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-173.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q6GEW8

Expression Region

1-173

Origin

Staphylococcus aureus (strain MRSA252)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTETANLFFLGAAGGVEWGTVIVQVLTFIVLLALLKKFAWGPLKDVMDKRERDINRDIDD AEQAKLNAQKLEEENKQKLKETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQ SEINSQKERAIADINNQVSELSVLIASKVLRKEISEQDQKALVDKYLKEAGDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Keratin 14 (KRT14) Antibody Pair
abx370944-01 5x 96 Tests

Keratin 14 (KRT14) Antibody Pair

Sign In for Pricing
View Details
Keratin 14 (KRT14) Antibody Pair
abx370944-02 10x 96 Tests

Keratin 14 (KRT14) Antibody Pair

Sign In for Pricing
View Details
Anti-HLA-A2-peptide (KVLEHVVRV) Complex Antibody (H2aM31345N)
ARO-A21137-01 50 µg

Anti-HLA-A2-peptide (KVLEHVVRV) Complex Antibody (H2aM31345N)

Sign In for Pricing
View Details
Anti-HLA-A2-peptide (KVLEHVVRV) Complex Antibody (H2aM31345N)
ARO-A21137-02 100 µg

Anti-HLA-A2-peptide (KVLEHVVRV) Complex Antibody (H2aM31345N)

Sign In for Pricing
View Details
Anti-HLA-A2-peptide (KVLEHVVRV) Complex Antibody (H2aM31345N)
ARO-A21137-03 1 mg

Anti-HLA-A2-peptide (KVLEHVVRV) Complex Antibody (H2aM31345N)

Sign In for Pricing
View Details
100 μl (50.5mm) ; boxed filtered pipette tip
HLXT-200 96 pcs/box, 10 boxes/medium box, 5 medium boxes/ctn

100 μl (50.5mm) ; boxed filtered pipette tip

Sign In for Pricing
View Details