Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bifidobacterium longum ATP synthase subunit b (atpF)

This Recombinant Bifidobacterium longum ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-173.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q8G7A9

Expression Region

1-173

Origin

Bifidobacterium longum (strain NCC 2705)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMTQAASGIDLFIPEVYDIVWSLIILVIVAVFFYKFFMPKFNAIFDERAAKIQGNIAKAE QARKDADEAKAKYEAQLSTARVDAAKIRDDARAEASHIIADARSRAESDAAQITASAQRS IESQHQQAIVSLKGEVGALATALAGKILGAKLEDNDVQSSMIDSMIDDLGAKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Cytisus sscoparius Lectin (Scotch broom) -CSA-,  10nm
GP-3201-10 1 mL

Colloidal Gold Conjugated Cytisus sscoparius Lectin (Scotch broom) -CSA-, 10nm

Sign In for Pricing
View Details
Human RCOR3 activation kit by CRISPRa
GA110944 1 Kit

Human RCOR3 activation kit by CRISPRa

Sign In for Pricing
View Details
Human Kinesin 2 (KNS2) ELISA Kit
RDR-KNS2-Hu-01 96 Tests

Human Kinesin 2 (KNS2) ELISA Kit

Sign In for Pricing
View Details
Human Kinesin 2 (KNS2) ELISA Kit
RDR-KNS2-Hu-02 48 Tests

Human Kinesin 2 (KNS2) ELISA Kit

Sign In for Pricing
View Details
Mouse Nhlh2 activation kit by CRISPRa
GA202901 1 Kit

Mouse Nhlh2 activation kit by CRISPRa

Sign In for Pricing
View Details
Inmt (NM_009349) Mouse Recombinant Protein
TP503504 20 µg

Inmt (NM_009349) Mouse Recombinant Protein

Sign In for Pricing
View Details