Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bifidobacterium longum ATP synthase subunit b (atpF)

This Recombinant Bifidobacterium longum ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-173.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q8G7A9

Expression Region

1-173

Origin

Bifidobacterium longum (strain NCC 2705)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMTQAASGIDLFIPEVYDIVWSLIILVIVAVFFYKFFMPKFNAIFDERAAKIQGNIAKAE QARKDADEAKAKYEAQLSTARVDAAKIRDDARAEASHIIADARSRAESDAAQITASAQRS IESQHQQAIVSLKGEVGALATALAGKILGAKLEDNDVQSSMIDSMIDDLGAKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kappa Light Chain (TB28-2), CF594 conjugate, 0.1mg/mL
BNC940708-500 1x 500 µL

Kappa Light Chain (TB28-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sarafloxacin
TRC-S139503-500MG 500 mg

Sarafloxacin

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone: femur, distal
CS712172 5x 5 µm

Tissue FFPE Sections, Bone: femur, distal

Sign In for Pricing
View Details
Rat MCAM / CD146 Protein, His Tag
MCM-R52H4-1mg 1 mg

Rat MCAM / CD146 Protein, His Tag

Sign In for Pricing
View Details
Plasma/Serum RNA Purification Midi Kit
56100 20 Preparations

Plasma/Serum RNA Purification Midi Kit

Sign In for Pricing
View Details
Protein A Texas Red Colloidal Gold, 1mL 10nm
TGP-01-10 1 mL

Protein A Texas Red Colloidal Gold, 1mL 10nm

Sign In for Pricing
View Details