Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit b (atpF)

This Recombinant Staphylococcus aureus ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-173.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q99SF1

Expression Region

1-173

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTETANLFVLGAAGGVEWGTVIVQVLTFIVLLALLKKFAWGPLKDVMDKRERDINRDIDD AEQAKLNAQKLEEENKQKLKETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQ SEINSQKERAIADINNQVSELSVLIASKVLRKEISEQDQKALVDKYLKEAGDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

His tag Recombinant Rabbit mAb, BF680 conjugated
orb3125573 100 µL

His tag Recombinant Rabbit mAb, BF680 conjugated

Sign In for Pricing
View Details
Tert-Butyl 4- (cyanomethyl) -4-hydroxypiperidine-1-carboxylate
OR1066520-01 100 mg

Tert-Butyl 4- (cyanomethyl) -4-hydroxypiperidine-1-carboxylate

Sign In for Pricing
View Details
Tert-Butyl 4- (cyanomethyl) -4-hydroxypiperidine-1-carboxylate
OR1066520-02 250 mg

Tert-Butyl 4- (cyanomethyl) -4-hydroxypiperidine-1-carboxylate

Sign In for Pricing
View Details
Tert-Butyl 4- (cyanomethyl) -4-hydroxypiperidine-1-carboxylate
OR1066520-03 1 g

Tert-Butyl 4- (cyanomethyl) -4-hydroxypiperidine-1-carboxylate

Sign In for Pricing
View Details
Tert-Butyl 4- (cyanomethyl) -4-hydroxypiperidine-1-carboxylate
OR1066520-04 5 g

Tert-Butyl 4- (cyanomethyl) -4-hydroxypiperidine-1-carboxylate

Sign In for Pricing
View Details
N-Nitroso Guvacoline
TRC-N527625-5MG 5 mg

N-Nitroso Guvacoline

Sign In for Pricing
View Details