Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein C14orf132 (C14orf132)

This Recombinant Human Putative uncharacterized protein C14orf132 (C14orf132) spans the amino acid sequence from region 1-173.

Product Specifications

Product Name Alternative

Putative uncharacterized protein C14orf132

UniProt

Q9NPU4

Expression Region

1-173

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMAQLFLLQANAVLPLSHEIKVKRQIRLPAPLYPPERNDSRSFQIPQDLREKGWEEGQQH FAGKAADAFPAPVQLEGLEAGQTTLASPEVGPWRPKRLSGVCLLSALLPDPCKTNGTFLL QKHHLPSLLAVILFPVIILTGASFAHLFVALFVSHLLLKLPLGAGMRMQRDAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse mmu-miR-346-3p miRNA Agomir
abx883470-01 5 nmol

Mouse mmu-miR-346-3p miRNA Agomir

Sign In for Pricing
View Details
Mouse mmu-miR-346-3p miRNA Agomir
abx883470-02 10 nmol

Mouse mmu-miR-346-3p miRNA Agomir

Sign In for Pricing
View Details
Human Neprilysin 2 (NEP2) ELISA Kit
MBS9311529-01 48 Well

Human Neprilysin 2 (NEP2) ELISA Kit

Sign In for Pricing
View Details
Human Neprilysin 2 (NEP2) ELISA Kit
MBS9311529-02 96 Well

Human Neprilysin 2 (NEP2) ELISA Kit

Sign In for Pricing
View Details
Human Neprilysin 2 (NEP2) ELISA Kit
MBS9311529-03 5x 96 Well

Human Neprilysin 2 (NEP2) ELISA Kit

Sign In for Pricing
View Details
Human Neprilysin 2 (NEP2) ELISA Kit
MBS9311529-04 10x 96 Well

Human Neprilysin 2 (NEP2) ELISA Kit

Sign In for Pricing
View Details