Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit b (atpF)

This Recombinant Staphylococcus aureus ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-173.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A5IUQ2

Expression Region

1-173

Origin

Staphylococcus aureus (strain JH9)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTETANLFVLGAAGGVEWGTVIVQVLTFIVLLALLKKFAWGPLKDVMDKRERDINRDIDD AEQAKLNAQKLEEENKQKLKETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQ SEINSQKERAIADINNQVSELSVLIASKVLRKEISEQDQKALVDKYLKEAGDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IDO1/TDO-IN-7
orb2664858-01 10 mg

IDO1/TDO-IN-7

Sign In for Pricing
View Details
IDO1/TDO-IN-7
orb2664858-02 50 mg

IDO1/TDO-IN-7

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Pregnenolone (PGN)
MBS2143471-01 0.1 mL

FITC-Linked Monoclonal Antibody to Pregnenolone (PGN)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Pregnenolone (PGN)
MBS2143471-02 0.2 mL

FITC-Linked Monoclonal Antibody to Pregnenolone (PGN)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Pregnenolone (PGN)
MBS2143471-03 0.5 mL

FITC-Linked Monoclonal Antibody to Pregnenolone (PGN)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Pregnenolone (PGN)
MBS2143471-04 1 mL

FITC-Linked Monoclonal Antibody to Pregnenolone (PGN)

Sign In for Pricing
View Details