Recombinant Lysinibacillus sphaericus ATP synthase subunit b (atpF)
This Recombinant Lysinibacillus sphaericus ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-173.
Product Specifications
Product Name Alternative
ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b
UniProt
B1HM52
Expression Region
1-173
Origin
Lysinibacillus sphaericus (strain C3-41)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MYLDYLVLGAGASKFNNGDIIATLAIFLVLMFLLKKVAWGPLMGIMQQREELVASEIEAA EKARKESHQFLEEQKSLLKEARTEAQSIVEGAKKQGELQKDEILTAARNEANRLKESALR EIESEKEKAIAAVRDEVVSLSVLAASKVLSKEISEADNRALIEETIAKAGEAR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TA349844 100 µL
Cytochrome P450 2C9 (CYP2C9) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
A1125-11G-AP 200 µL
AKT1, CT (RAC-alpha Serine/Threonine-protein Kinase, RAC-PK-alpha, Protein Kinase B, PKB, Proto-oncogene c-Akt, PKB, RAC) (AP) discontinued
Sign In for Pricing
View Details 