Recombinant Lysinibacillus sphaericus ATP synthase subunit b (atpF)
This Recombinant Lysinibacillus sphaericus ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-173.
Product Specifications
Product Name Alternative
ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b
UniProt
B1HM52
Expression Region
1-173
Origin
Lysinibacillus sphaericus (strain C3-41)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MYLDYLVLGAGASKFNNGDIIATLAIFLVLMFLLKKVAWGPLMGIMQQREELVASEIEAA EKARKESHQFLEEQKSLLKEARTEAQSIVEGAKKQGELQKDEILTAARNEANRLKESALR EIESEKEKAIAAVRDEVVSLSVLAASKVLSKEISEADNRALIEETIAKAGEAR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx233178 100 µg
Fibronectin Type III Domain Containing Protein 5 (FNDC5) Antibody
Sign In for Pricing
View Details 
T5498-80-ML490 100 µL
Tie2 Receptor (Tunica Internal Endothelial Cell Kinase Receptor, Angiopoietin1 Receptor, p140 Tek, Tyrosine Protein Kinase Receptor) (MaxLight 490) discontinued
Sign In for Pricing
View Details