Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Scheffersomyces stipitis Altered inheritance of mitochondria protein 11 (AIM11)

This Recombinant Scheffersomyces stipitis Altered inheritance of mitochondria protein 11 (AIM11) spans the amino acid sequence from region 1-174.

Product Specifications

Product Name Alternative

Altered inheritance of mitochondria protein 11

UniProt

A3LP48

Expression Region

1-174

Origin

Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) (Yeast) (Pichia stipitis)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVEAASNSSDQSGLKPFLAKYNFKLGEASDEYIARRKRQMVLFMSSAALTIFASRFAYK STISRQYIPTLFQGNHAPPLSYNFATDAAVAVGTGTLLCGSVSSMVIFGSCWILDVSNFK EFGWKMKSMMGGYEKERELSKLPMDEESAYIQDGLNDILEGKYDFDEDGTEEGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL
BNC940178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL
BNC682848-100 1x 100 µL

Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL
BNC680029-500 1x 500 µL

Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF405S conjugate, 0.1mg/mL
BNC040189-100 1x 100 µL

CD74 (BU45), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 6 (MUC6) (MUC6/916), CF740 conjugate, 0.1mg/mL
BNC740916-100 1x 100 µL

Mucin 6 (MUC6) (MUC6/916), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details