Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dinoroseobacter shibae ATP synthase subunit b' (atpG)

This Recombinant Dinoroseobacter shibae ATP synthase subunit b' (atpG) spans the amino acid sequence from region 1-174.

Product Specifications

Product Name Alternative

ATP synthase subunit b', ATP synthase F (0) sector subunit b', ATPase subunit II, F-type ATPase subunit b', F-ATPase subunit b'

UniProt

A8LKH8

Expression Region

1-174

Origin

Dinoroseobacter shibae (strain DFL 12)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATEATGAVEAAPGMPQLDFSTFPNQIFWLIITLVAIYLILTKVALPRIGSVLAERSGTI TNDLAAAEELKLAAVEAEKAYNQALADARAEAQKIVAEARAEIQADLDVATAKADAEIAA KSAEAEKAIAEIREGAMASVTEVATDTAQALVAALLPSAKDADVSAAVAERVKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CF®790 Free Acid
#92159 1x 250 nmol

CF®790 Free Acid

Sign In for Pricing
View Details
ATG12 Rabbit Polyclonal Antibody
R1404-1 100 µL

ATG12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4-Nitrophenyl Propionate
TRC-N926178-25MG 25 mg

4-Nitrophenyl Propionate

Sign In for Pricing
View Details
Human KRBOX1 activation kit by CRISPRa
GA119297 1 Kit

Human KRBOX1 activation kit by CRISPRa

Sign In for Pricing
View Details
Metolachlor ESA Sodium Salt
TRC-M338710-25MG 25 mg

Metolachlor ESA Sodium Salt

Sign In for Pricing
View Details
Smim24 Mouse Gene Knockout Kit (CRISPR)
KN516326 1 Kit

Smim24 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details