Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yuaF (yuaF)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yuaF (yuaF) spans the amino acid sequence from region 1-174.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yuaF

UniProt

O32077

Expression Region

1-174

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELFGVPIQTMYLYTLIIAGSLTLLFLFFGDVFSGLSEGIPFLNPTLVLSFFTCFSAGGY IGELVLPLSSLLIALLSCILSIMLVVLLHIFVLVPLSSAEESLAYREDDLRGRLGKVITA VPVDGFGEVVIEGIGGTISKSAVSFDNQQISYGTTVLVVDINNGVLSVTPHEPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SCARB1 Antibody
RC-4565-01 50 μL

Recombinant SCARB1 Antibody

Sign In for Pricing
View Details
Recombinant SCARB1 Antibody
RC-4565-02 100 µL

Recombinant SCARB1 Antibody

Sign In for Pricing
View Details
Recombinant SCARB1 Antibody
RC-4565-03 1 mL

Recombinant SCARB1 Antibody

Sign In for Pricing
View Details
Calbindin 1 (CALB1) (CALB1/3333), CF405S conjugate, 0.1mg/mL
BNC043333-100 1x 100 µL

Calbindin 1 (CALB1) (CALB1/3333), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Osteopontin Recombinant Rabbit Monoclonal Antibody [PSH08-59] - BSA and Azide free (Detector)
HA723005 100 µL

Human Osteopontin Recombinant Rabbit Monoclonal Antibody [PSH08-59] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
FBP1 (NM_000507) Human Recombinant Protein
TP720120 10 µg

FBP1 (NM_000507) Human Recombinant Protein

Sign In for Pricing
View Details