Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Tail-anchored protein insertion receptor WRB (WRB)

This Recombinant Bovine Tail-anchored protein insertion receptor WRB (WRB) spans the amino acid sequence from region 1-174.

Product Specifications

Product Name Alternative

Tail-anchored protein insertion receptor WRB, Tryptophan-rich basic protein, WRB

UniProt

Q3SZ26

Expression Region

1-174

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSAAEADRWAWLLVLSFVFGCNVLRILLPSFSFFMSRVLQKDAEQESQMRAEIQGMKQEL STVNMMDEFARYARLERKINKMTDKLKTHVKARTAQLAKIKWVISVAFYILQAALMVSLI WKYYSVPVAVVPSKWITPLDRLVAFPTRVAGGVGITCWILVCNKVVAIVLHPFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL
BNC551037-500 1x 500 µL

CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL
BNC400181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF640R conjugate, 0.1mg/mL
BNC400525-100 1x 100 µL

CD63 (MX-49.129.5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL
BNC041820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF740 conjugate, 0.1mg/mL
BNC740218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF647 conjugate, 0.1mg/mL
BNC470193-100 1x 100 µL

CD86 (BU63), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details