Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-174.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

Q4G3A9

Expression Region

1-174

Origin

Emiliania huxleyi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRTYISGSRRLSNIFWALTITLGGLGFFLNGCSSYFNTNLLIFSDASSIAFIPQGIILMF YGTVALILGLFLCLTIIWDVGFGYNDYNADQITVYRKGFPGKNRELNLTFPSEVVKSIKV RVTEGLNPRRQLFLCLKDSREIPLTGVDQPAALNKIENEAVTLAKYLNVFLETE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Ethyl-adenine
TRC-E677515-50MG 50 mg

3-Ethyl-adenine

Sign In for Pricing
View Details
THADA Rabbit Polyclonal Antibody
TA365902 100 µL

THADA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human TMEM119 activation kit by CRISPRa
GA117390 1 Kit

Human TMEM119 activation kit by CRISPRa

Sign In for Pricing
View Details
Human NEK10 activation kit by CRISPRa
GA115823 1 Kit

Human NEK10 activation kit by CRISPRa

Sign In for Pricing
View Details
GNAT3 Polyclonal Antibody
E-AB-16465-01 20 µL

GNAT3 Polyclonal Antibody

Sign In for Pricing
View Details
GNAT3 Polyclonal Antibody
E-AB-16465-02 60 µL

GNAT3 Polyclonal Antibody

Sign In for Pricing
View Details