Recombinant Rat Tail-anchored protein insertion receptor WRB (Wrb)
This Recombinant Rat Tail-anchored protein insertion receptor WRB (Wrb) spans the amino acid sequence from region 1-174.
Product Specifications
Product Name Alternative
Tail-anchored protein insertion receptor WRB, Tryptophan-rich basic protein, WRB
UniProt
Q6P6S5
Expression Region
1-174
Origin
Rattus norvegicus (Rat)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSASETDRWAWLLVLCFVFGCNVLRILLPTLSSFISRVLQKDAEQESQMRAEIQSMKQEL STVNMMDEFARYARLERKINKMTDKLKTHVKARTAQLAKIKWFISVAFYVLQAALMISLI WKYYSVPVAVVPSKWITPLDRLVAFPTRVAGGIGVTCWILVCNKVVAIILHPFS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400096-500 1x 500 µL
Histone H1 (AE-4), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740523-100 1x 100 µL
AFP (Alpha Fetoprotein) (C2), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742983-100 1x 100 µL
Neurofilament (NF-L) (Neuronal Marker) (NEFL/2983R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741932-100 1x 100 µL
CD44v4 (Marker of Tumor Metastasis) (rCD44v4/1219), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details