Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit b (atpF)

This Recombinant ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-174.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

P26681

Expression Region

1-174

Origin

Enterococcus hirae

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLNQLAIAEVGNPMLGNIIVVSGSFLILMFLLKHFAWGPISDILKKREDKIANDLDSAEK SRINSAKMEQEREQQLLASRSDAADIIKNAKESGELSRQNILKETQEEVARLKSKAQTDI MLERDTALNSVKDDVADLSLQIAAKILNKELSPEMHESLINQYIEGLGSSNETR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1559962 3'UTR Luciferase Stable Cell Line
TU218120 1.0 mL

RGD1559962 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
SCGB3A2 (NM_054023) Human Tagged ORF Clone
RG205635 10 µg

SCGB3A2 (NM_054023) Human Tagged ORF Clone

Sign In for Pricing
View Details
SDHDP1 3'UTR Luciferase Stable Cell Line
TU022800 1.0 mL

SDHDP1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Armc8 (NM_028768) Mouse Tagged Lenti ORF Clone
MR219078L4 10 µg

Armc8 (NM_028768) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lamin B1 Rabbit pAb
MBS8541714-01 0.1 mL

Lamin B1 Rabbit pAb

Sign In for Pricing
View Details
Lamin B1 Rabbit pAb
MBS8541714-02 0.1 mL (AF405L)

Lamin B1 Rabbit pAb

Sign In for Pricing
View Details