Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant General secretion pathway protein B (pulB)

This Recombinant General secretion pathway protein B (pulB) spans the amino acid sequence from region 1-174.

Product Specifications

Product Name Alternative

General secretion pathway protein B, Pullulanase operon protein PULB

UniProt

P20725

Expression Region

1-174

Origin

Klebsiella pneumoniae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLVRPQEPYPQSEPPAAVGRMVQIPYVTVPLYAALLIALGWFGGEQWRNKPEPQPMRQSV AHAALVPLNQPAVKAAVAPVNAGPEIQAEPEIAIDEDNLPPLRYSAHVYASLADKRSIVL NGQSWKEGDSPLANLVIEHIQQDLTVFSFNGKTFTLAALDDWPGGAIEESPQAE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL4I1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1076006 1.0 µg DNA

IL4I1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
AFAP1L1 siRNA (Mouse)
CRN0795-01 15 nmol

AFAP1L1 siRNA (Mouse)

Sign In for Pricing
View Details
AFAP1L1 siRNA (Mouse)
CRN0795-02 30 nmol

AFAP1L1 siRNA (Mouse)

Sign In for Pricing
View Details
fibrillin-2 Double Nickase Plasmid (h2)
sc-406714-NIC-2 20 µg

fibrillin-2 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
THOP1 Protein Vector (Mouse) (pPB-N-His)
PV238163 500 ng

THOP1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
CRISPLD2 Recombinant Protein Antigen
NBP2-68613PEP 100 µL

CRISPLD2 Recombinant Protein Antigen

Sign In for Pricing
View Details