Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ywjB (ywjB)

This Recombinant Bacillus subtilis Uncharacterized protein ywjB (ywjB) spans the amino acid sequence from region 1-174.

Product Specifications

Product Name Alternative

Uncharacterized protein ywjB

UniProt

P45862

Expression Region

1-174

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERKTVLYIAVSLDGMIAKEDGSIDWLDEFEGEGDNGYSDFYQTVDTVILGRSTYEHVKV LTPVFPYQDKTCYVFTGSPDSYQDEHVTFINEGARAFTARLKQEKGSNIWIAGGAELVND FMKEDAIDEFIITVIPVVLGSGIPLFHELTNETKLRLKGTKQFGQAVQLHYVRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ACK (N-GST tag)
MBS4160002-01 0.01 mg

Recombinant Human ACK (N-GST tag)

Sign In for Pricing
View Details
Recombinant Human ACK (N-GST tag)
MBS4160002-02 5x 0.01 mg

Recombinant Human ACK (N-GST tag)

Sign In for Pricing
View Details
GATA-5 Double Nickase Plasmid (m)
sc-420497-NIC 20 µg

GATA-5 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Human SHH (Hedgehog Homolog, Sonic) CLIA Kit
MBS2531236-01 96 Tests

Human SHH (Hedgehog Homolog, Sonic) CLIA Kit

Sign In for Pricing
View Details
Human SHH (Hedgehog Homolog, Sonic) CLIA Kit
MBS2531236-02 5x 96 Tests

Human SHH (Hedgehog Homolog, Sonic) CLIA Kit

Sign In for Pricing
View Details
HESL Lentiviral Activation Particles (h2)
sc-415923-LAC-2 200 µL

HESL Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details