Recombinant Botryotinia fuckeliana Altered inheritance of mitochondria protein 31, mitochondrial (aim31)
This Recombinant Botryotinia fuckeliana Altered inheritance of mitochondria protein 31, mitochondrial (aim31) spans the amino acid sequence from region 1-175.
Product Specifications
Product Name Alternative
Altered inheritance of mitochondria protein 31, mitochondrial
UniProt
A6SSX6
Expression Region
1-175
Origin
Botryotinia fuckeliana (strain B05.10) (Noble rot fungus) (Botrytis cinerea)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSNSTPLPSSFDGDTDFYEENRWQKLTRRLKEEPLIPLGCILTSLALVGASRSIRAGDHN RTQRMFRARIYAQGFTLLAMVAGSMYWDSDRKKRKEFEGVLAETKAKEKNEAWIRELEAR DEEEKEMRRARDERRRRAEGRPAPKAVVTDAPAEEGEKPKGGVMEQMSGLVWGKK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC402853-100 1x 100 µL
CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402823-100 1x 100 µL
BMI1 (Oncogene and Stem Cell Marker) (BMI1/2823), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details