Recombinant Pelodictyon luteolum ATP synthase subunit b 2 (atpF2)
This Recombinant Pelodictyon luteolum ATP synthase subunit b 2 (atpF2) spans the amino acid sequence from region 1-175.
Product Specifications
Product Name Alternative
ATP synthase subunit b 2, ATP synthase F (0) sector subunit b 2, ATPase subunit I 2, F-type ATPase subunit b 2, F-ATPase subunit b 2
UniProt
Q3B143
Expression Region
1-175
Origin
Pelodictyon luteolum (strain DSM 273) (Chlorobium luteolum (strain DSM 273) )
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MLTSGNILLAGSLLSPEPGLIFWTTITFVLVLIILKKIAWGPIISALEEREKGIQSSIDR AHGAKEESEAILRQNRELLAKADAEADRVIREGREYAEKIRAEITEKAHQESQKMISAAK EEIEQEKRRALAELRNEVADLAVRGAEKIIRGVLDADVQKKVVDSMIQDLSTNRN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681073-100 1x 100 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680904-100 1x 100 µL
CD34 (QBEnd/10 + HPCA1/763), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470873-100 1x 100 µL
P34 / cdk1 (CDK1/873), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942421-500 1x 500 µL
BOB.1 (B-Cell Marker) (BOB1/2421), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details