Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gibberella zeae Protein SYM1 (SYM1)

This Recombinant Gibberella zeae Protein SYM1 (SYM1) spans the amino acid sequence from region 1-175.

Product Specifications

Product Name Alternative

Protein SYM1

UniProt

Q4IPX8

Expression Region

1-175

Origin

Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) (Wheat head blight fungus) (Fusarium graminearum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSFIRWYNSRLAARPLLTQSVTTAFLFATGDVTAQQLVEKRGAQKHDLVRTGRMALYGG FVFGPVATTWFAFLARRVNVRNNKKAEVLARVACDQLGFAPVMIGVFLSSMATMEGKSVK ERIDKTWWPALKANWMVWPAVQVINFSLIPLQYRLFFANIIAIGWNSYLSWVNSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Bromo-4- (4-ethylphenyl) pyrimidine
OR11579 1 Each

5-Bromo-4- (4-ethylphenyl) pyrimidine

Sign In for Pricing
View Details
RPL17P40 3'UTR GFP Stable Cell Line
TU070844 1.0 mL

RPL17P40 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Cyclo (his-pro)
orb1220309-01 200 mg

Cyclo (his-pro)

Sign In for Pricing
View Details
Cyclo (his-pro)
orb1220309-02 500 mg

Cyclo (his-pro)

Sign In for Pricing
View Details
Cyclo (his-pro)
orb1220309-03 1 g

Cyclo (his-pro)

Sign In for Pricing
View Details
Cyclo (his-pro)
orb1220309-04 5 mg

Cyclo (his-pro)

Sign In for Pricing
View Details