What is the catalog number for Recombinant Gibberella zeae Protein SYM1 (SYM1)?

The catalog number for Recombinant Gibberella zeae Protein SYM1 (SYM1) is orb2930492.

What sizes are available for Recombinant Gibberella zeae Protein SYM1 (SYM1)?

Recombinant Gibberella zeae Protein SYM1 (SYM1) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Gibberella zeae Protein SYM1 (SYM1) come in?

Recombinant Gibberella zeae Protein SYM1 (SYM1) is available in 2 different pack sizes.

Is Recombinant Gibberella zeae Protein SYM1 (SYM1) in stock?

Recombinant Gibberella zeae Protein SYM1 (SYM1) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Gibberella zeae Protein SYM1 (SYM1)

This Recombinant Gibberella zeae Protein SYM1 (SYM1) spans the amino acid sequence from region 1-175.

Product Specifications

Product Name Alternative

Protein SYM1

UniProt

Q4IPX8

Expression Region

1-175

Origin

Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) (Wheat head blight fungus) (Fusarium graminearum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSFIRWYNSRLAARPLLTQSVTTAFLFATGDVTAQQLVEKRGAQKHDLVRTGRMALYGG FVFGPVATTWFAFLARRVNVRNNKKAEVLARVACDQLGFAPVMIGVFLSSMATMEGKSVK ERIDKTWWPALKANWMVWPAVQVINFSLIPLQYRLFFANIIAIGWNSYLSWVNSQ