Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATP synthase subunit b (atpF)

This Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-175.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q49Z54

Expression Region

1-175

Origin

Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTATTNMFVLGAAGTSGVQWGTIIVTLVTFLILLALLKKFAWGPLKDVMDKREHDINKDI DDAEQAKLNAQKLEEQNKQTLKETQDEVQKILEESKVQARKQHEEIIHEANIRANGMIET AQNEINSEKERAIADINNQVSELSVLIASKVLQKEISDKDQKALVEKYIKEAGDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Tumor Necrosis Factor Related Apoptosis Inducing Ligand (TRAIL) ELISA Kit
EKU07983 96 Tests

Rat Tumor Necrosis Factor Related Apoptosis Inducing Ligand (TRAIL) ELISA Kit

Sign In for Pricing
View Details
Olr56 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7203506 1.0 µg DNA

Olr56 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Arium Pro UV Water Sys. Bench
WAT4250 1 Each

Arium Pro UV Water Sys. Bench

Sign In for Pricing
View Details
PUS10, NT (PUS10, CCDC139, DOBI, Putative tRNA pseudouridine synthase Pus10, Coiled-coil domain-containing protein 139, tRNA pseudouridine 55 synthase, tRNA pseudouridylate synthase, tRNA-uridine isomerase) (Biotin)
MBS6339197-01 0.2 mL

PUS10, NT (PUS10, CCDC139, DOBI, Putative tRNA pseudouridine synthase Pus10, Coiled-coil domain-containing protein 139, tRNA pseudouridine 55 synthase, tRNA pseudouridylate synthase, tRNA-uridine isomerase) (Biotin)

Sign In for Pricing
View Details
PUS10, NT (PUS10, CCDC139, DOBI, Putative tRNA pseudouridine synthase Pus10, Coiled-coil domain-containing protein 139, tRNA pseudouridine 55 synthase, tRNA pseudouridylate synthase, tRNA-uridine isomerase) (Biotin)
MBS6339197-02 5x 0.2 mL

PUS10, NT (PUS10, CCDC139, DOBI, Putative tRNA pseudouridine synthase Pus10, Coiled-coil domain-containing protein 139, tRNA pseudouridine 55 synthase, tRNA pseudouridylate synthase, tRNA-uridine isomerase) (Biotin)

Sign In for Pricing
View Details
Ckmt1b Rat shRNA Plasmid (Locus ID 29593)
TL701775 1 Kit

Ckmt1b Rat shRNA Plasmid (Locus ID 29593)

Sign In for Pricing
View Details