Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mitochondrial inner membrane protease subunit 2 (Immp2l)

This Recombinant Mouse Mitochondrial inner membrane protease subunit 2 (Immp2l) spans the amino acid sequence from region 1-175.

Product Specifications

Product Name Alternative

Mitochondrial inner membrane protease subunit 2, EC= 3.4.21.-, IMP2-like protein

UniProt

Q8BPT6

Expression Region

1-175

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQSQSWARRCFKAFCKGFFVAVPVAVTFLDRVACVARVEGSSMQPSLNPGGSQSSDVVL LNHWKVRNFEVQRGDIVSLVSPKNPEQKIIKRVIALEGDIVRTIGHKNRLVKVPRGHMWV EGDHHGHSFDSNSFGPVSLGLLHAHATHILWPPERWQRLESVLPPERCPLQTGEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Streptavidin, PerCP Conjugate, 0.5 mg/mL
#29140-200uL 1x 200 µL

Streptavidin, PerCP Conjugate, 0.5 mg/mL

Sign In for Pricing
View Details
Crabp2 Mouse Gene Knockout Kit (CRISPR)
KN503795 1 Kit

Crabp2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BG45
TRC-B366500-5MG 5 mg

BG45

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS624967 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
Protein A Gel Immobilized Proteins
ABP-01-2 2 mL

Protein A Gel Immobilized Proteins

Sign In for Pricing
View Details
Human MALT1-AS1 activation kit by CRISPRa
GA119465 1 Kit

Human MALT1-AS1 activation kit by CRISPRa

Sign In for Pricing
View Details