Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial inner membrane protease subunit 2 (IMMP2L)

This Recombinant Human Mitochondrial inner membrane protease subunit 2 (IMMP2L) spans the amino acid sequence from region 1-175.

Product Specifications

Product Name Alternative

Mitochondrial inner membrane protease subunit 2, EC= 3.4.21.-, IMP2-like protein

UniProt

Q96T52

Expression Region

1-175

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQSQGWVKRYIKAFCKGFFVAVPVAVTFLDRVACVARVEGASMQPSLNPGGSQSSDVVL LNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALEGDIVRTIGHKNRYVKVPRGHIWV EGDHHGHSFDSNSFGPVSLGLLHAHATHILWPPERWQKLESVLPPERLPVQREEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTNNA2 (NM_004389) Human Recombinant Protein
TP308731L 1 mg

CTNNA2 (NM_004389) Human Recombinant Protein

Sign In for Pricing
View Details
Ubiquitin (Autophagy Marker) (UBB/1748), 0.2mg/mL
BNUB1748-100 1x 100 µL

Ubiquitin (Autophagy Marker) (UBB/1748), 0.2mg/mL

Sign In for Pricing
View Details
NKAPD1 (NM_001082970) Human Over-expression Lysate
LY421201 100 µg

NKAPD1 (NM_001082970) Human Over-expression Lysate

Sign In for Pricing
View Details
TGF beta 1 (TGFB1) Rabbit Polyclonal Antibody
AP06350PU-N 100 µg

TGF beta 1 (TGFB1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-17-alpha-hydroxyprogesterone antibody *Mouse anti-human, monoclonal IgG1*
V100195-AAT 50 µg

Anti-17-alpha-hydroxyprogesterone antibody *Mouse anti-human, monoclonal IgG1*

Sign In for Pricing
View Details
TPM1 (NM_001018007) Human Recombinant Protein
TP319652 20 µg

TPM1 (NM_001018007) Human Recombinant Protein

Sign In for Pricing
View Details