Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit b, chloroplastic (atpF)

This Recombinant ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-175.

Product Specifications

Product Name Alternative

ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I

UniProt

Q9TM28

Expression Region

1-175

Origin

Cyanidium caldarium

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRSQSLNFVASNTTSDFISNLLESNVINIIILISLLIYLGKRTIVTNLNDRKLNIQCSIL EAEKKLSQAQLRLAEAEKKITESEEIISILKHEAKIAANKIKELIVNNAKRKIDKIILDG KTIIANTEIEIMNQIKNRIISTAIDKTKIKLTKNLQAETIERITDNKITFLNNNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR4KD Polyclonal Antibody
ABP59710-01 30 µL

OR4KD Polyclonal Antibody

Sign In for Pricing
View Details
OR4KD Polyclonal Antibody
ABP59710-02 100 µL

OR4KD Polyclonal Antibody

Sign In for Pricing
View Details
OR4KD Polyclonal Antibody
ABP59710-03 200 µL

OR4KD Polyclonal Antibody

Sign In for Pricing
View Details
FBXO34 (NM_152231) Human Tagged Lenti ORF Clone
RC226104L4 10 µg

FBXO34 (NM_152231) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral human ADGRG7 sgRNA gene knockout kit - Lentiviral human ADGRG7 sgRNA gene knockout kit (plasmid)
GTR15385901 1 Vial

Lentiviral human ADGRG7 sgRNA gene knockout kit - Lentiviral human ADGRG7 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Prss23 3'UTR GFP Stable Cell Line
TU266903 1.0 mL

Prss23 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details