Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit b, chloroplastic (atpF)

This Recombinant ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-175.

Product Specifications

Product Name Alternative

ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I

UniProt

Q9TM28

Expression Region

1-175

Origin

Cyanidium caldarium

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRSQSLNFVASNTTSDFISNLLESNVINIIILISLLIYLGKRTIVTNLNDRKLNIQCSIL EAEKKLSQAQLRLAEAEKKITESEEIISILKHEAKIAANKIKELIVNNAKRKIDKIILDG KTIIANTEIEIMNQIKNRIISTAIDKTKIKLTKNLQAETIERITDNKITFLNNNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H69V
ABC-TC0284 1 Vial

H69V

Sign In for Pricing
View Details
SLC25A33 Recombinant Protein (Rat)
RP229235 100 µg

SLC25A33 Recombinant Protein (Rat)

Sign In for Pricing
View Details
FOS/c-FOS Antibody
orb1538886 50 μL

FOS/c-FOS Antibody

Sign In for Pricing
View Details
Recombinant Mouse Hexosaminidase B Beta (HEXb)
RPU41903-01 50 µg

Recombinant Mouse Hexosaminidase B Beta (HEXb)

Sign In for Pricing
View Details
Recombinant Mouse Hexosaminidase B Beta (HEXb)
RPU41903-02 100 µg

Recombinant Mouse Hexosaminidase B Beta (HEXb)

Sign In for Pricing
View Details
Recombinant Mouse Hexosaminidase B Beta (HEXb)
RPU41903-03 1 mg

Recombinant Mouse Hexosaminidase B Beta (HEXb)

Sign In for Pricing
View Details