Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sphingopyxis alaskensis ATP synthase subunit b (atpF)

This Recombinant Sphingopyxis alaskensis ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-176.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q1GU76

Expression Region

1-176

Origin

Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) (Sphingomonas alaskensis)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADFTLILAEGVVEPTAFGLDATVWVSIAMLVFLGILVWKGVPGAIAAMLDKRIAEISKQ LGEAEQLRLDAESLKAEYEAKLADAAKEADEMRARADAEAQALVAKAKADATALIARRKQ MAEDRIAAAEANALAEVRAAAVKAATEAAAKLIADRHDVAADKALVDQAIASIAKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Talnetant
TRC-T005545-1G 1 g

Talnetant

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: right
CS700421 5x 5 µm

Tissue FFPE Sections, Colon: right

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast, right
CS712691 5x 5 µm

Tissue FFPE Sections, Breast, right

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), Biotin conjugate, 0.1mg/mL
BNCB1387-100 1x 100 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Occludin (OCLN) (Tight Junctions Marker) (OCLN/2183), 1mg/mL
BNUM2183-50 1x 50 µL

Occludin (OCLN) (Tight Junctions Marker) (OCLN/2183), 1mg/mL

Sign In for Pricing
View Details
FECH (NM_000140) Human Over-expression Lysate
LC400049 20 µg

FECH (NM_000140) Human Over-expression Lysate

Sign In for Pricing
View Details