Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sphingopyxis alaskensis ATP synthase subunit b (atpF)

This Recombinant Sphingopyxis alaskensis ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-176.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q1GU76

Expression Region

1-176

Origin

Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) (Sphingomonas alaskensis)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADFTLILAEGVVEPTAFGLDATVWVSIAMLVFLGILVWKGVPGAIAAMLDKRIAEISKQ LGEAEQLRLDAESLKAEYEAKLADAAKEADEMRARADAEAQALVAKAKADATALIARRKQ MAEDRIAAAEANALAEVRAAAVKAATEAAAKLIADRHDVAADKALVDQAIASIAKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Human CD7 Antibody[HIT7]
E-AB-F1315D-01 20 Tests

PE Anti-Human CD7 Antibody[HIT7]

Sign In for Pricing
View Details
PE Anti-Human CD7 Antibody[HIT7]
E-AB-F1315D-02 100 Tests

PE Anti-Human CD7 Antibody[HIT7]

Sign In for Pricing
View Details
PE Anti-Human CD7 Antibody[HIT7]
E-AB-F1315D-03 2x 100 Tests

PE Anti-Human CD7 Antibody[HIT7]

Sign In for Pricing
View Details
UAP56 (DDX39B) Mouse Monoclonal Antibody [Clone ID: OTI2G7]
CF812666 100 µg

UAP56 (DDX39B) Mouse Monoclonal Antibody [Clone ID: OTI2G7]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD326/EpCAM Antibody[G8.8]
E-AB-F1181UH-01 25 µg

PE/Cyanine7 Anti-Mouse CD326/EpCAM Antibody[G8.8]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD326/EpCAM Antibody[G8.8]
E-AB-F1181UH-02 100 µg

PE/Cyanine7 Anti-Mouse CD326/EpCAM Antibody[G8.8]

Sign In for Pricing
View Details