Recombinant Aspergillus oryzae Altered inheritance of mitochondria protein 31, mitochondrial (aim31)
This Recombinant Aspergillus oryzae Altered inheritance of mitochondria protein 31, mitochondrial (aim31) spans the amino acid sequence from region 1-176.
Product Specifications
Product Name Alternative
Altered inheritance of mitochondria protein 31, mitochondrial
UniProt
Q2UGQ3
Expression Region
1-176
Origin
Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSSDPVPSSFEGNPQFEEETSLQKFRRRLKEEPLIPLGCAATSYALYRAYRSMKAGDSVE MNRMFRARIYAQFFTLIAVVVGGMYFKTERQQRKEFERMVEERKSQEKRDAWLRELEIRD KEDKDWRQRHAAMEAAAAEAGKKTAPHDAARSAIERSEEKSIGVLDAVKELLSRRN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC881081-500 1x 500 µL
CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400050-500 1x 500 µL
IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882110-100 1x 100 µL
PTEN (Tumor Suppressor Oncoprotein) (PTEN/2110), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400729-500 1x 500 µL
Ku-Holo (p70;83) (KU729), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details